SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679214|ref|NP_933823.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679214|ref|NP_933823.1|
Domain Number 1 Region: 5-259,359-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.5e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000000019
Further Details:      
 
Domain Number 2 Region: 451-588
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.96e-46
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.000000585
Further Details:      
 
Domain Number 3 Region: 236-356
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.69e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.000000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679214|ref|NP_933823.1|
Sequence length 588
Comment succinate dehydrogenase flavoprotein subunit [Vibrio vulnificus YJ016]
Sequence
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNS
HKDDWQWHMYDTVKGSDYIGDQNAIEYMCKNGPESVIELEKMGLPFSRFDNGSIYQRPFG
GQSKEFGGEQAARTAAAADRTGHALLHTLYQQNVKHKTMIFSEWYALDLVKNQDGAVVGC
TAVCMETGEICYFKSKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKDVLESRLPGICELSRTFAHVDPVKEPIPVIPTCHYMMGGV
PTQVSGQAIKQTADGKDVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLAAQAEARDASASDIEASLSRYMRWENSKGGEDPVQIRKDLQRCMQNSFSVFREGDAM
ATGLEELKVIRERLKDAHLSDKSTEFNTQRIECLELDNLMETAFSTAVAANYRTESRGAH
ARFDFPDRDDENWLCHSIYNPETEQMSKRDVNMTPVHRDAFPPKVRTY
Download sequence
Identical sequences A0A087JEM6 A0A0H0Y3J9 Q7MMN7
gi|320157043|ref|YP_004189422.1| gi|37679214|ref|NP_933823.1| WP_011078276.1.100126 WP_011078276.1.13374 WP_011078276.1.17874 WP_011078276.1.21633 WP_011078276.1.24453 WP_011078276.1.25536 WP_011078276.1.28215 WP_011078276.1.28571 WP_011078276.1.30871 WP_011078276.1.31968 WP_011078276.1.34622 WP_011078276.1.39407 WP_011078276.1.39524 WP_011078276.1.43691 WP_011078276.1.47396 WP_011078276.1.49981 WP_011078276.1.512 WP_011078276.1.53782 WP_011078276.1.54486 WP_011078276.1.54603 WP_011078276.1.54858 WP_011078276.1.55006 WP_011078276.1.553 WP_011078276.1.58875 WP_011078276.1.58885 WP_011078276.1.59022 WP_011078276.1.59048 WP_011078276.1.59451 WP_011078276.1.60167 WP_011078276.1.60868 WP_011078276.1.61535 WP_011078276.1.63462 WP_011078276.1.63825 WP_011078276.1.65015 WP_011078276.1.66581 WP_011078276.1.67868 WP_011078276.1.73066 WP_011078276.1.73173 WP_011078276.1.78369 WP_011078276.1.79678 WP_011078276.1.81060 WP_011078276.1.81460 WP_011078276.1.82587 WP_011078276.1.8292 WP_011078276.1.8379 WP_011078276.1.84562 WP_011078276.1.86005 WP_011078276.1.86748 WP_011078276.1.89979 WP_011078276.1.90288 WP_011078276.1.93668 WP_011078276.1.95941 WP_011078276.1.96968 WP_011078276.1.9921 WP_011078276.1.99976 gi|27363642|ref|NP_759170.1| 196600.VV1030 216895.VV1_0159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]