SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679270|ref|NP_933879.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679270|ref|NP_933879.1|
Domain Number 1 Region: 779-877
Classification Level Classification E-value
Superfamily PKD domain 0.0000392
Family PKD domain 0.018
Further Details:      
 
Domain Number 2 Region: 283-356
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000467
Family Zinc protease 0.044
Further Details:      
 
Weak hits

Sequence:  gi|37679270|ref|NP_933879.1|
Domain Number - Region: 241-265
Classification Level Classification E-value
Superfamily EF-hand 0.0169
Family EF-hand modules in multidomain proteins 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679270|ref|NP_933879.1|
Sequence length 1005
Comment hypothetical protein VV1086 [Vibrio vulnificus YJ016]
Sequence
MNKWLFFTLALALSASATATVPPAPIWHDVELSDGSSTKVRLTGNADFHWYEDEQGNALI
EQQDKWFFAEIKNEGAKPYLISSGDAKLADSQPPLSAQDRSALQVTPSHASLPERPVTQR
SRSMQQTPFSTRSAFASRAQPFEQPLLVVQVSFSNISMDHDFTELVFSDVNQSVVDYYDK
NSFGQYRVVPAQETYGTANDGVISIRVSQQHPNCHDSQICTNRLNSIFSEAYRLIDQYVD
FSTYDLNRDGSIDPTELSVMFVFAGGDRSTGVLTKPAIWPHMYFHNAVYVDGKYISAYCL
FADYQVNHQSTLGVIVHELGHLMLDLPDLYSYNHKGSVGSWGVMGAGSWAMKEGDLYAGE
TPVNMSAWSRHAAGFINPQILTSSDNDVQIVNQQAAIVNLDPYLQEFGPRLYVENRRKQD
YDRALTAEGVLVTSVNINHAFNHTGPMQVQIMQADGLAELENGGWTDGADVYPGDSQNSL
ISDNSHPSLTSITGFATGVSLNNIASSDAFASFLFRRPVEGYDFAWMTSLRRSYVVSEAE
KNSAAFAVTLSSDSVLEGVQLYYQVLNALQPVEYVVASYPVSNANFASLVLNPAERIVLA
QGSTFGNGRLLFDAPAKLAMGSHTLVIELTNAQLEQNYQFSELQNMEPEGSKTIWLGNSQ
TSSSDGMNKLLPYHLIPFAALLDRDISELLLPVNDRVEVSKNGSLQLMLTSNDRIDATLA
GQVEVHIVTQPQHGRLGGLTYTAPSYFVGSDRFSYRLQTADGRMISDVANVEVVVVGDNV
APVVNVDVQASQLIAGQRVQLNGTTTQDPDGDPLNYQWRQTFGPSVSLSGTDSDTAQFTI
PASARMGDVFAFTLEASDPSGLSHSDHVQIVIVNTPPVAQDDHVSVKVGERIDITPLAND
SDHDGQTLQITQVSQPTFGSVSLIDNQIRYQAPEEMASTSEVALHYTVSDSEGATAQGRV
MITVSSTTAVVASSSSSGSSGGGMGGVMVVILGLLGVWRTRNQNH
Download sequence
Identical sequences Q7MMI5
gi|37679270|ref|NP_933879.1| WP_011149831.1.34622 196600.VV1086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]