SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679290|ref|NP_933899.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679290|ref|NP_933899.1|
Domain Number 1 Region: 594-769
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-59
Family ATP-dependent protease Lon (La), catalytic domain 0.0000000878
Further Details:      
 
Domain Number 2 Region: 312-586
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-51
Family Extended AAA-ATPase domain 0.0000827
Further Details:      
 
Domain Number 3 Region: 10-200
Classification Level Classification E-value
Superfamily PUA domain-like 2.49e-48
Family LON domain-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679290|ref|NP_933899.1|
Sequence length 783
Comment ATP-dependent Lon protease [Vibrio vulnificus YJ016]
Sequence
MNLERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSISCLESAMEANKQVLLVAQKQADT
DEPTVDDLFEVGTVATILQLLKLPDGTVKVLVEGQQRAKINQFKESDFFLAEAEFIVTPE
LDEREQEVIVRSAISQFEGFIKLNKKIPPEVLTSLGGIDEAARLADTIAAHMPLKLADKQ
QVLETVDITERLEFLMGQMESEIDILQVEKRIRNRVKKQMEKSQREYYLNEQMKAIQKEL
GESEDGVDEFEALKQKIDSAKMPKEAREKTEQELQKLKMMSPMSAEATVVRSYIDWMVNV
PWNKRSKVKKDLAKAEEVLNEDHYGLERVKDRILEYLAVQNRINKLKGPILCLVGPPGVG
KTSLGRSIAAATGRQYVRMALGGVRDEAEIRGHRRTYIGSLPGKLIQKMAKVGVKNPLFL
LDEIDKMSSDMRGDPASALLEVLDPEQNNSFNDHYLEVDYDLSDVMFVATSNSMNIPGPL
LDRMEVIRLSGYTEDEKLNIAKRHLVAKQVERNGLKPHEINIEDSAIIGIIRFYTREAGV
RSLEREISKICRKAVKNILLKPELKSVTVNIDNLKEYLGVQRFDYGKADDSNRVGQVTGL
AWTEVGGDLLTIETEAMPGKGKLTQTGSLGDVMQESIQAAMTVVRSRAEKLGINSDFYEK
KDIHVHVPEGATPKDGPSAGIAMCTALVSSLTGNPVKAEVAMTGEITLRGEVLPIGGLKE
KLLAAHRGGITTVLIPKDNERDLEEIPDNVIADLKVIPVQWIDEVLKVALERDPTGVEFD
AKK
Download sequence
Identical sequences A0A1W6M2F3 Q7MMG5
gi|326423650|ref|NP_759038.2| WP_011078147.1.16238 WP_011078147.1.17874 WP_011078147.1.21633 WP_011078147.1.22778 WP_011078147.1.34622 WP_011078147.1.49981 WP_011078147.1.54486 WP_011078147.1.55006 WP_011078147.1.58885 WP_011078147.1.66219 WP_011078147.1.66581 WP_011078147.1.73066 WP_011078147.1.73173 WP_011078147.1.81460 WP_011078147.1.8379 WP_011078147.1.86005 WP_011078147.1.90288 WP_011078147.1.93668 WP_011078147.1.95941 WP_011078147.1.99976 gi|37679290|ref|NP_933899.1| 196600.VV1106 gi|320156967|ref|YP_004189346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]