SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679313|ref|NP_933922.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679313|ref|NP_933922.1|
Domain Number 1 Region: 794-1011
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000361
Further Details:      
 
Domain Number 2 Region: 290-489
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.45e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000236
Further Details:      
 
Domain Number 3 Region: 40-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.001
Further Details:      
 
Domain Number 4 Region: 139-181,268-324
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.4e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.004
Further Details:      
 
Domain Number 5 Region: 554-657
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.75e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0037
Further Details:      
 
Domain Number 6 Region: 704-788
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 7.06e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0017
Further Details:      
 
Domain Number 7 Region: 183-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0000000000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679313|ref|NP_933922.1|
Sequence length 1037
Comment multidrug resistance protein [Vibrio vulnificus YJ016]
Sequence
MLLSDVSVKRPVAALVLSLLLCVFGFVSFSKLAVREMPDIESPVVSISTRYDGASATIIE
SQITSVLEDQLSGISGIDEISSTTRNSMSRITITFELGYDLNTGVSDVRDAVARAQRSLP
EEADDPIVFKNNGSGEASVYINLSSSEMDRTQLTDYIERVLMDRFSLITGVSSVDISGGL
YKVMYVKLSPELMAGRGVTATDITAALRSENLESPGGQVRNDQTVMSVRTARSYNSVEDF
QYLVVKRASDNTPIYLKDVADVFIGAENENSTFKSDGVVNVSMGIVPQSDANPLEVAKRV
HEEVDKVQKFLPEGTRLAIDYDSTVFIERSISEVYSTLFITGGLVILVLYIFIGQARATL
IPAVTVPVSLISSFIAAYYFGFSINLITLMALILSIGLVVDDAIVVVENIFHHIEKGESP
LLAAYKGTREVGFAVIATTLVLVMVFLPISFMDGMVGLLFTEFSVLLAMSVIFSSLIALT
LTPVLGSKILKANVKKNRFNDVVDVLFGKLESGYRALLKRALAWRWLAPVIILACMGGSY
ALMNQVPAQLTPQEDRGVIFAFVRGADATSYNRMSANMDLVEERLMPLLGQGFLKSFSIQ
SPAFGGQAGDQTGFVIMILDDWNERSVTAQQALGEVRKALAGIPDVRVFPFMPGFRGGSS
EPVQFVLGGSDYNELRDWAEVLKNKAEESPIMEGAEINYSEKTPELVVSVDKRRAAELGI
SIKEISDTLEIMLGGRKETTFVERGEEYDVYLRGDENRFNNAADLSQIYLRTKSGDLVTL
DTVTNVEEIASSIRLSHYNKQKAITITANLSDGYTLGDALDFLDQQAIETLPGDITISYS
GESKDFKENQSSVAIVFALALLVAYLVLAAQFESFINPLVVMFTVPMGVFGGFLGLLIMQ
QGMNIYSQIGMIMLIGMVTKNGILIVEFANQLRDRGFEFEQAIIDASARRLRPILMTAFT
TLAGAIPLILSDGAGYESRVAVGTVIFFGMGFATLVTLFVIPAMYRLISRYTEAPGHVEA
ELNQALSHDTKGRVSHG
Download sequence
Identical sequences Q7MME3
gi|37679313|ref|NP_933922.1| WP_011149859.1.34622 WP_011149859.1.90288 196600.VV1129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]