SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679316|ref|NP_933925.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679316|ref|NP_933925.1|
Domain Number 1 Region: 23-335
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 5.5e-70
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679316|ref|NP_933925.1|
Sequence length 361
Comment cysteine synthase [Vibrio vulnificus YJ016]
Sequence
MCTDHNWINNAIRKIEADFQRSADTHLFKLDLPSLEGIDIYLKDESTHPTGSLKHRLARS
LFLYAICNGWIGPETTVIESSSGSTAVSEAYFARLLGLPFIAVMPKCTARKKIEQIEFYG
GKAHLVDRSDQIYAESHRLAKELNGHYMDQFTYAERATDWRGNNNIANSIFSQMTLEEHP
EPSWIVMSPGTGGTSATIGRFIRYQKLDTKLCVVDPENSVFFDYFQNGDNTITGNTGSKI
EGIGRPRVEPSFIAGVVDEMRKIPDAASVACTHWVSKLIGRKVGASTGTNLYGVLQLACE
MKQRGERGSIVTLLCDSGDRYLDTYFNEEWVKTNIGDIQPYLEQLEIIERDGCVAPICCP
A
Download sequence
Identical sequences A0A0H0Y896 A0A1L9L5I2 A0A1V8MZ06 Q7MME0
gi|37679316|ref|NP_933925.1| 196600.VV1133 WP_011149862.1.16238 WP_011149862.1.21633 WP_011149862.1.22778 WP_011149862.1.34622 WP_011149862.1.39524 WP_011149862.1.53345 WP_011149862.1.54486 WP_011149862.1.55006 WP_011149862.1.58885 WP_011149862.1.79678 WP_011149862.1.82587 WP_011149862.1.90288 WP_011149862.1.94371 WP_011149862.1.9921 WP_011149862.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]