SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679359|ref|NP_933968.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679359|ref|NP_933968.1|
Domain Number 1 Region: 452-863
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 7.33e-115
Family Iron-containing alcohol dehydrogenase 0.00000232
Further Details:      
 
Domain Number 2 Region: 5-454
Classification Level Classification E-value
Superfamily ALDH-like 1.01e-84
Family ALDH-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679359|ref|NP_933968.1|
Sequence length 891
Comment bifunctional acetaldehyde-CoA/alcohol dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDAIFRAASLAANQARIPLAQMAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLEAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVDAVYDEVKERFASHKAYVLSKAEAEKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSYDDAFAHEKLSPTLGLFRADDFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKR
AFLVTDRFLFNNGYADDVVQLLKAQGMEVQTFFDVEADPTLSVVEKGAAAMQSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKGNLDIPMSIQAAGVAEADFLAKVDELAVEAFDDQC
TGANPRYPLIAELKEVLLASYYGKAFVEGETFEGTTVIKKKADQVAPKAKK
Download sequence
Identical sequences A0A0H0Y223 A0A1L9L7F4 A0A1W6M2M7 Q7MM98
gi|326424135|ref|NP_761906.2| WP_011080912.1.16238 WP_011080912.1.17874 WP_011080912.1.25536 WP_011080912.1.33883 WP_011080912.1.34622 WP_011080912.1.43691 WP_011080912.1.54486 WP_011080912.1.55006 WP_011080912.1.73066 WP_011080912.1.79678 WP_011080912.1.81060 WP_011080912.1.81460 WP_011080912.1.8379 WP_011080912.1.90288 WP_011080912.1.93668 WP_011080912.1.94371 WP_011080912.1.9921 WP_011080912.1.99976 gi|320156889|ref|YP_004189268.1| gi|37679359|ref|NP_933968.1| 196600.VV1175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]