SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679401|ref|NP_934010.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679401|ref|NP_934010.1|
Domain Number 1 Region: 5-387
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 8.51e-142
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.00000000000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679401|ref|NP_934010.1|
Sequence length 396
Comment tryptophan synthase subunit beta [Vibrio vulnificus YJ016]
Sequence
MTKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMGLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEETVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDSITDDEALDAFQELARSEGIIPALESSHALAHALKM
ARNNPEKEQLLVVNLSGRGDKDIFTVHAILEEKGAI
Download sequence
Identical sequences A0A087IL39 A0A0H0Y250 A0A1L9L7L9 Q7MM56 Q8D8B2
gi|320156846|ref|YP_004189225.1| WP_011080871.1.16238 WP_011080871.1.17874 WP_011080871.1.21633 WP_011080871.1.22778 WP_011080871.1.25536 WP_011080871.1.28215 WP_011080871.1.28571 WP_011080871.1.30871 WP_011080871.1.33883 WP_011080871.1.34622 WP_011080871.1.39407 WP_011080871.1.43691 WP_011080871.1.47396 WP_011080871.1.49981 WP_011080871.1.53345 WP_011080871.1.53782 WP_011080871.1.54486 WP_011080871.1.54603 WP_011080871.1.55006 WP_011080871.1.553 WP_011080871.1.58875 WP_011080871.1.58885 WP_011080871.1.59048 WP_011080871.1.59451 WP_011080871.1.60167 WP_011080871.1.60868 WP_011080871.1.61535 WP_011080871.1.63462 WP_011080871.1.63825 WP_011080871.1.65015 WP_011080871.1.66219 WP_011080871.1.66581 WP_011080871.1.67868 WP_011080871.1.73066 WP_011080871.1.78668 WP_011080871.1.79678 WP_011080871.1.81060 WP_011080871.1.81460 WP_011080871.1.81555 WP_011080871.1.8379 WP_011080871.1.84562 WP_011080871.1.86005 WP_011080871.1.90288 WP_011080871.1.93668 WP_011080871.1.94371 WP_011080871.1.9921 WP_011080871.1.99976 196600.VV1217 216895.VV1_3068 gi|27366337|ref|NP_761865.1| gi|37679401|ref|NP_934010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]