SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679418|ref|NP_934027.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679418|ref|NP_934027.1|
Domain Number 1 Region: 16-100
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 3.27e-23
Family GIY-YIG endonuclease 0.0053
Further Details:      
 
Domain Number 2 Region: 521-609
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.67e-19
Family Excinuclease UvrC C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 190-243
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000000123
Family C-terminal UvrC-binding domain of UvrB 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679418|ref|NP_934027.1|
Sequence length 610
Comment excinuclease ABC subunit C [Vibrio vulnificus YJ016]
Sequence
MTQIFDSVSFLKTVTHQPGVYRMYNAEAVVIYVGKAKDLKKRLSSYFRKKVDSEKTKALV
SNIAKIDVTVTHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFLSAHRHPRVSLHRG
AKKRKGEYFGPYPDSGAVRETLHLIQKIFPVRQCEDTVYANRTRPCLMYQIGRCAGPCVS
SVISDVDYAELVGYLRLFLQGKDNQVLELLVQKMEIASQQLKFEDAAKFRDQIQAIRRVQ
EQQYVSEDSQEDMDVLGFAQENGIACIHILMIRQGKVLGSRSHFPKIPQNTNAQEVFDSF
LTQYYLSHNEARTIPSRIILNQELAADVEAIQLALSDVAGRKVQFHTSPSGSRGRYLKLS
NTNALTAMTTKINHKMTINQRFKALRDVLAMDSIARMECFDISHTMGESTIASCVVFNSE
GPVKQEYRRYNITGITGGDDYAAMGQALERRYAKQLDVEKIPDVIFIDGGKGQLNRAHEI
IAQYWGDWPKRPVMIGIAKGVTRKPGLETLITVDGDEFHLPSDDPALHLIQHIRDESHNH
AIAGHRAKRGKTRKTSALEGIEGVGPKRRQALLKYTGGLQELKRASVEEIAKVPGISHSL
AEIIYQALKQ
Download sequence
Identical sequences A0A2J9Y263 Q7MM39
gi|37679418|ref|NP_934027.1| WP_011149939.1.25536 WP_011149939.1.34622 WP_011149939.1.73066 WP_011149939.1.8379 WP_011149939.1.9921 196600.VV1234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]