SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679519|ref|NP_934128.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679519|ref|NP_934128.1|
Domain Number 1 Region: 1-299,382-413
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-55
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679519|ref|NP_934128.1|
Sequence length 430
Comment amino-oxidase [Vibrio vulnificus YJ016]
Sequence
MKIAIIGTGISGLTCGYHLYKAHDITLFEANDYIGGHTATIDFALNGKDYSVDTGFIVYN
DRTYPNFINMMDEIGVTGRATQMSFSVRNDSNGLEYNGHTLATLFAQKRNWFKPQFYSFI
FEILRFNKLAKASAKHDDIAQQTLGEFLDTHGFSDYFSDNYILPMGAAIWSSTLADMRAF
PLTFFLRFFLNHGLLDVTNRPQWYVIDGGSKAYIPPLTKGFSDRIRLNCPVEKVIRDSTG
VTLYVAGEAQRFDHVIFACHSDQAMSLLEDASCDEASILSRMAYQANEVVLHTDDSLLPR
RKAAWASWNYLLDGKEGEDTRLPSLTYNMNILQHIEAEHTFCVTLNSSDKIDEDKVIRKF
VYHHPVFTTESIAAQQRRDDIQGRNHTWFCGAYWYNGFHEDGVRSALDVVRGINLVQAKE
EATSFHQGAA
Download sequence
Identical sequences Q7MLU2
196600.VV1335 WP_011150008.1.34622 gi|37679519|ref|NP_934128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]