SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37679537|ref|NP_934146.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679537|ref|NP_934146.1|
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily HAD-like 1.32e-39
Family Histidinol phosphatase-like 0.00000335
Further Details:      
 
Domain Number 2 Region: 169-253
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-32
Family Imidazole glycerol phosphate dehydratase 0.00016
Further Details:      
 
Domain Number 3 Region: 254-344
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-31
Family Imidazole glycerol phosphate dehydratase 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679537|ref|NP_934146.1|
Sequence length 357
Comment imidazole glycerol-phosphate dehydratase/histidinol phosphatase [Vibrio vulnificus YJ016]
Sequence
MSKQQKILFIDRDGTLIVEPPVDFQVDRLDKLKLEPFVIPSLLSLQDAGYRLVMVTNQDG
LGTDSYPQEDFDAPHNMMMEIFESQGVKFDDVLICPHFEKDNCSCRKPKLGLVKEYLQAG
KVDFQNSFVIGDRQTDLQLAENMAIRGIQYNPETMGWKQILKDLTVKARVAEVVRTTKET
DIKVFVNLDEQGGNAISTGLGFFDHMLDQIATHGGFQMVCKVEGDLHIDDHHTVEDTALA
LGQALKEALGDKRGIGRFGFSLPMDECLAQCALDLSGRPYLKFDAQFSREQVGDLSTEMV
VHFFRSLTDTLACTLHLSSAGNNDHHIIESLFKAFGRTLRQAIKVEGTELPSSKGVL
Download sequence
Identical sequences Q7MLS4
196600.VV1353 gi|37679537|ref|NP_934146.1| WP_011150022.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]