SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679546|ref|NP_934155.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679546|ref|NP_934155.1|
Domain Number 1 Region: 50-362
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.18e-104
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000173
Further Details:      
 
Domain Number 2 Region: 365-508
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.62e-40
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679546|ref|NP_934155.1|
Sequence length 509
Comment cysteinyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MQNEGLSKLRFCVGSLVDYRFSAELLLPKNNVVGILPIHFSSINIQIEIMLKIYNTLTRQ
KEEFKPITAGKVGMYVCGVTIYDLCHIGHGRTFVSFDVVSRYLRYLGYDLTFVRNITDID
DKIIKRAAENGETCDSLTERLIGEMHADFDALNMKRPDVEPRATQYIQEIIELVERLIER
GFAYVADNGDVMFEVNKFDEYGKLSKQDLDQLQAGARVDVETAKRCPLDFVLWKMSKPGE
PTWESPWGPGRPGWHIECSAMNSSILGNHFDIHGGGSDLQFPHHENEIAQSCCAHDTQYV
NTWMHSGMVMVDKEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQ
ARASLERLYTSLRGLDFSAAPAGGEEYVSRFTAAMNDDFNTPEAYSVLFDMAREINRLKT
EDLANASALGALMRELADVIGILHQDPEAFLKGDAGNDDEVAEIEALIKLRNDSRAAKDW
ANADMARDKLNEMGIVLEDGPDGTTWRRK
Download sequence
Identical sequences 196600.VV1362 gi|37679546|ref|NP_934155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]