SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679553|ref|NP_934162.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37679553|ref|NP_934162.1|
Domain Number - Region: 330-366
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0188
Family Outer membrane lipoprotein 0.0092
Further Details:      
 
Domain Number - Region: 74-188
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0832
Family Tandem AAA-ATPase domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679553|ref|NP_934162.1|
Sequence length 461
Comment hypothetical protein VV1369 [Vibrio vulnificus YJ016]
Sequence
MNKMKLALAASMMLSIVGCQSTPEEKLTQEVTNEVAENASTPFVGIQQSHQQWSQALQDS
GKLAIYAPENFKDLTSAWKEASEIYTKLEKDPSLASKSYSLFSSDTYAQAYQEQIKLVDQ
NFAALEKLKAKADVILADSIAQMDYLAEINAAKLYANDYNKVLSQYKKLFSYVVVDELEE
AQEKQVVFLNTAKQLEVKVVHKTFILPLQQELKTLKKEDFNEVAPVSFATAENVINIAAN
IAQTNPRDKAAIELAVANAQFEIEHVKQVTHQVKLLASVEDDAFENSVLEIENKLLAISK
AVDGSDYRDVMLREQSEKILASVKRMHEANKTTDLSQQVTELNSKVKVLETKSAEQKTAL
EKANQRELALNAHIEREAAHIKSLEELVANLKLQLAAKDQPASTVEQADPVQEGTALEEQ
APQVEEAAPKAEAIETEEAASDVEASSETAAPETQPESAAE
Download sequence
Identical sequences A0A2J9Y1T3 Q7MLQ8
gi|37679553|ref|NP_934162.1| WP_011150036.1.25536 WP_011150036.1.34622 WP_011150036.1.73066 196600.VV1369 gi|320156691|ref|YP_004189070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]