SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679581|ref|NP_934190.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679581|ref|NP_934190.1|
Domain Number 1 Region: 810-1032
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.05e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00058
Further Details:      
 
Domain Number 2 Region: 307-506
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.49e-34
Family Multidrug efflux transporter AcrB transmembrane domain 0.00046
Further Details:      
 
Domain Number 3 Region: 55-150
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.31e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0047
Further Details:      
 
Domain Number 4 Region: 151-197,285-338
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.33e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0054
Further Details:      
 
Domain Number 5 Region: 199-282
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000837
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0096
Further Details:      
 
Domain Number 6 Region: 729-804
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000017
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.013
Further Details:      
 
Weak hits

Sequence:  gi|37679581|ref|NP_934190.1|
Domain Number - Region: 575-621
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0011
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679581|ref|NP_934190.1|
Sequence length 1035
Comment AcrB/AcrD/AcrF family transporter [Vibrio vulnificus YJ016]
Sequence
MSDKPVVSPQSDDEVTGVAAYFIRNRVISWMISLIFLIGGVAAFFGLGRLEDPAFTIKDA
MVVTSYPGATPQQVEEEVTYPLEKAIQQLTYVDEVNSISSRGLSQITVTMKNNYGPDDLP
QIWDELRRKVNDLKGQLPPGVNDPQVIDDFGDVYGILLAVTGDGYSYKELLDYVDYLRRE
LELVDGVSKVSVTGQQQEQVFIEISMKRLSSLGISPNTVFNLLSTQNVVSDAGAIRIGDE
YIRIHPTGEFQNVDQLGDLIITESGAQGLIYLRDVADIKRGYVEVPNNIINFNGKLALNV
GVSFAQGVNVVEVGKSFDRRLAELKYQQPVGIDISEIYSQPKEVDKSVSGFVVSLGQAVA
IVIIVLLFFMGLRSGLLIGLILLLTVLGTFIFMQYFKIDLQRISLGALVIALGMLVDNAI
VVVEGILIGTQKGRTRLQAATDIVTQTKWPLLGATVIAVTAFAPIGLSEDATGEYCGTLF
TVLLISLMLSWFTAISLTPFFADIFFKGQKVNVSESGEEVDPYNGMIFVVYKNFLEFCMK
RAWLTMIVLVLGLGVSLYGFTLVKQAFFPSSTTPMFQADIWLPEGTDIRATNTKLKALES
WLAEQDNVEHITTTAGKGLQRFMLTYAPEKSYAAYGEITTRVTSYEALDPLMAKFRQHVK
ENFPEINYKLKQIELGPGGGAKIEARIIGSDPTVLRSIAAQVMDIMYADAGATNVRHDWR
ERTKVLEPQFNESQARRYGITKSDVDDFLAMSFSGMAIGIYRDGTTLMPIVARLPDEERV
DIRNIEGMKIWSPALSEFIPLQQVTLGYELLWEDPIIVRKNRKRVLTVMADPDILGEETA
STLQKRLMPQIEAIQLPPGYSLEWGGEYESSRDAQASLFTTMPMGYLFMFLITVFLFNSV
KEPLIVWLTVPLAVIGVTTGLLALNTPFGFMALLGFLSLSGMLLKNGIVLLDQIEIEMKS
GKDPYVAVVDAALSRVRPVCMAAITTILGMVPLLPDIFFKPMAVTIMFGLGFATILTLIV
VPVLYRLFHKVAVPK
Download sequence
Identical sequences A0A1V8MYM7 Q7MLN0
gi|27366153|ref|NP_761681.1| gi|320156665|ref|YP_004189044.1| gi|37679581|ref|NP_934190.1| WP_011080696.1.17874 WP_011080696.1.25536 WP_011080696.1.34622 WP_011080696.1.39524 WP_011080696.1.54486 WP_011080696.1.58885 WP_011080696.1.73066 WP_011080696.1.73173 WP_011080696.1.82587 WP_011080696.1.8379 WP_011080696.1.90288 WP_011080696.1.99976 196600.VV1397 216895.VV1_2874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]