SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679624|ref|NP_934233.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679624|ref|NP_934233.1|
Domain Number 1 Region: 1-380
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 5.5e-89
Family Iron-containing alcohol dehydrogenase 0.0000669
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679624|ref|NP_934233.1|
Sequence length 415
Comment alcohol dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MFQFMTATRIIFGEGALQSSLSILSQFGYSALLVTGKDLARAMPIIGYFKSQNIRYQHVA
ISGEPNITMVEETAVIGRKFKPDMVVAIGGGSVIDMGKALAAIIPNQGDVYDYVEVVGRN
VPLKTQPIHFIAIPTTASTGSEVTRNAVLKSGQDKVKVSLRSPDMLADVAIVDPTLTYGT
DAYTSGRGAMDAFTHLMEAYVCGEPNPLTDMICEEGLRRLSHSIIPGCLQDDYKARSDLA
FSAMLGGMAITNAKLGAAHGLASALGGKLDAPHSVITAQLAPHVMNENIMAAREAGRADV
LTRYKSLARLVTKNGDASELEGVEWVKGVLDKLQLPELSQFGVCSTSFDAVAEDALRSVA
IKGNPLPLTKARLIYILEQVCQCRLRSEQTQQEATGCAQFIESEDYNLEMGNEIK
Download sequence
Identical sequences A0A0H0Y2M1 A0A1L9L8B7 A0A1V8MYR6 Q7MLI7
gi|27366108|ref|NP_761636.1| WP_011080655.1.100126 WP_011080655.1.16238 WP_011080655.1.17874 WP_011080655.1.21633 WP_011080655.1.22778 WP_011080655.1.34622 WP_011080655.1.39524 WP_011080655.1.53345 WP_011080655.1.54858 WP_011080655.1.55006 WP_011080655.1.58885 WP_011080655.1.59022 WP_011080655.1.66581 WP_011080655.1.78369 WP_011080655.1.79678 WP_011080655.1.81060 WP_011080655.1.81460 WP_011080655.1.82587 WP_011080655.1.8292 WP_011080655.1.89979 WP_011080655.1.94371 gi|37679624|ref|NP_934233.1| 196600.VV1440 216895.VV1_2826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]