SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679639|ref|NP_934248.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679639|ref|NP_934248.1|
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679639|ref|NP_934248.1|
Sequence length 321
Comment thioredoxin reductase [Vibrio vulnificus YJ016]
Sequence
MQMSDMKHSKLLILGSGPAGYTAAVYAARANLNPVLITGMQQGGQLTTTTEVENWPGDPE
GLTGPGLMNRMKEHAERFETEIIFDHINEVDFSTRPFVLKGDAASYSCDALIISTGASAK
YLGLESEEAFKGRGVSACATCDGFFYRNQKVAVVGGGNTAVEEALYLSNIAAEVHLIHRR
DSFRAEKILINRLMDKVQNGNIVLHTDRVLDEVLGDEMGVTGVRLKDVKTGGTEELDVMG
AFIAIGHSPNTQIFQGQLDMKDGYILVKSGLEGNATQTSVEGIFAAGDVMDHNYRQAITS
AGTGCMAALDAERYLDSLNDK
Download sequence
Identical sequences Q7MLH2
gi|37679639|ref|NP_934248.1| 196600.VV1455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]