SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679663|ref|NP_934272.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679663|ref|NP_934272.1|
Domain Number 1 Region: 9-329
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.51e-76
Family AstE/AspA-like 0.000000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679663|ref|NP_934272.1|
Sequence length 342
Comment succinylglutamate desuccinylase [Vibrio vulnificus YJ016]
Sequence
MTNSLFRQSFLSDTLNMQQSVEAKATTLSNGVRLQLHQRGVLEVIPANNSAETKNIILSS
GIHGDETAPMELIDKIVHDIETGFQDVQARCLFIIAHPEATNAHTRFIEENLNRLFDEKE
HQPSKELVIADQLKLLVKAFFDNTPVESRWHLDLHCAIRASKHYSFAISPKTRHPTRSKA
LVDFVNHSHVEALLLSNSPSSTFSWFSAEYYSAQALTMELGRVARIGENDLSRFTALDLT
MRDLIAEVTPEHLPKPAITYRVSRTIVRLHQDFDFRFDDQVENFTSFMHGEVFGHDGDKP
LMAKNDNEAIVFPNRNVAIGQRAALMVCEIKARFEDDQLVYD
Download sequence
Identical sequences Q7MLE8
gi|37679663|ref|NP_934272.1| 196600.VV1479 WP_011150118.1.34622 WP_011150118.1.54486 WP_011150118.1.73173 WP_011150118.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]