SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679678|ref|NP_934287.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679678|ref|NP_934287.1|
Domain Number 1 Region: 57-227,337-417
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.27e-59
Family Bacterial dinuclear zinc exopeptidases 0.0033
Further Details:      
 
Domain Number 2 Region: 227-339
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.11e-21
Family Bacterial exopeptidase dimerisation domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37679678|ref|NP_934287.1|
Sequence length 418
Comment di- and tripeptidase [Vibrio vulnificus YJ016]
Sequence
MVIFSLFKTSLLCQSVRLFDSTQFYCLTTMHNGAFCSYTGAAHSKREISRMIPVNQERLI
EHFCQLVRIDSESMNEKAIAEALAEQLGDMGFTVHKLPVPEHISNGFNVYARLEGELEGS
ILLSCHMDTVAPGNGIEPVIEDGIIRSKGNTILGGDDKSGIAAIMEAVRLLKEQNQQHKT
IELAFTVHEEGGLFGSEYFDMSYVTAQQAIVLDTGGPIGSIVTAAPGQQKIVATIKGRPA
HAGLAPEEGISAIMVAADAINQMKLLRIDAETTANIGTVHGGQATNIVMPELKIVAEARS
LNAEKLDAQVEHMITTFERVAEEHGAKVEIESSRAYNAFVLSDDHPHVVEIKQAFADIGV
DAMTKGTGGGSDANNFNAKGLTTVNLSTGMSKVHTTEEFIAIADMVKITEFLTHYLAK
Download sequence
Identical sequences Q7MLD3
gi|37679678|ref|NP_934287.1| 196600.VV1494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]