SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679791|ref|NP_934400.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679791|ref|NP_934400.1|
Domain Number 1 Region: 177-472
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.13e-126
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.00000000589
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.79e-56
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.000000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37679791|ref|NP_934400.1|
Sequence length 482
Comment 6-phosphogluconate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MKGDIGVIGLAVMGQNLILNMNDHGFKVVAHNRTAAKVDEFLEGPAKGTNIIGAYSLEEL
VEKLETPRKVMLMVRAGAVVDQFIDALVPLLDKGDIIIDGGNTNYPDTNRRVAALREKGI
HFIGTGVSGGEEGARFGPSIMPGGAPEAWEAVKPIFQGISAKTDAGEPCCDWVGNDGAGH
FVKMVHNGIEYGDMQLITEAYQFMKDGLGMSADEMQAVFADWNKTELDSYLVEITADILG
YKDEDGEPLVEKILDTAGQKGTGKWTGINALDLGIPLTLISESVFSRCLSALKDQRVEAE
KLFGKTITPVEGDKQEWVDALRQALLASKIISYAQGFMLMREASNENGWDLNYGNVALMW
RGGCIIRSAFLGNIRDAYEANPDLAFLGSDDYFKGILQNSLVAWRKVAAKSLEAGIPMPC
TTSALTFLDGYTTARLPANLLQAQRDYFGAHTYERIDRERGEFFHTNWTGTGGNTASTTY
DV
Download sequence
Identical sequences Q7ML20
196600.VV1607 gi|37679791|ref|NP_934400.1| WP_011150224.1.34622 WP_011150224.1.55006 WP_011150224.1.90288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]