SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679834|ref|NP_934443.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679834|ref|NP_934443.1|
Domain Number 1 Region: 203-449
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.57e-74
Family Leukotriene A4 hydrolase catalytic domain 0.002
Further Details:      
 
Domain Number 2 Region: 2-192
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.76e-48
Family Leukotriene A4 hydrolase N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679834|ref|NP_934443.1|
Sequence length 869
Comment aminopeptidase N [Vibrio vulnificus YJ016]
Sequence
MSQTPQAKYRKDYKAPSHTITDIDLTFDLYDHNTVVTAVSQVKQQGESDVLELDGEALKL
ISVAVNGEAWSAFEVKESSLVLSNLPAEFELVIVTEIDPEANTALEGLYKSGGAFCTQCE
AEGFRRITYYLDRPDVLARYQTKVIADKAQYPYLLSNGNRIAEGELEGGRHWVQWQDPHP
KPAYLFALVAGDFDVLRDTFVTKSGRSVDLEIFVDKGNLDRAPHAMTSLINSMKWDEERF
DLEYDLDIYMIVAVDFFNMGAMENKGLNIFNSKFVLANSQTATDADYLGIERVIGHEYFH
NWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDLGSRAVNRIQNVRTIRGPQFAEDASPMS
HPIRPDKVIEMNNFYTLTVYEKGSEVIRMYHTLLGEEGFQKGMKLYFERHDGTAATCEDF
VSAMEDATGVDLTQFRLWYSQSGTPTLRVSSQYDAEKQTYALTVEQSTEPTHEQAEKQPL
HIPFDIELYAANGDVIPMIIAGEPVGNVLDVKADKQTFVFENVAEKPVPSLLREFSAPVK
LEYDYSDRELMFLMVNARNEFSRWDASQMLLAKYIRQNVERVQAGEEVELPEAVVDAFRG
VLLNAELDSAFIAEVMSLPNHNEVSGWYKQVDVDAIAQVLKQLKMILATQLCDELSALYH
SLKQAEYTIEHAAIGQRALRNICLAYLAYTQEGNDLVLKQYQESNNMTDTIAAMASANQA
QLPCREALMQDYSDKWKHDGLVMDKWFILQGCNPAANALDVVKETMKHEAFSLKNPNRTR
SLIGSFLGMNPVNFHDKSGAGYRFAGEILRELNRTNPQVASRLVDPLLKLGKYDSDRQAL
IRQELKALQGLEDLAKDLFEKVSKALENE
Download sequence
Identical sequences Q7MKX7
gi|37679834|ref|NP_934443.1| 196600.VV1650 WP_011150259.1.34622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]