SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37679977|ref|NP_934586.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37679977|ref|NP_934586.1|
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily RelE-like 1.27e-28
Family YoeB/Txe-like 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37679977|ref|NP_934586.1|
Sequence length 90
Comment hypothetical protein VV1793 [Vibrio vulnificus YJ016]
Sequence
MMSSSQRLLSWTDDAWDDYLYWQTQDKKTLKRINKLINDVKRSPFEGIGKPEPLKENLSG
FWSRRIDDTNRLVYAVDDQAITIISCRYHY
Download sequence
Identical sequences A0A0D1F6B5 A0A0D1GIV7 A0A0F6LI54 Q7MKJ5 Q87NP8
gi|37679977|ref|NP_934586.1| 196600.VV1793 223926.VP1820 gi|28898594|ref|NP_798199.1| NP_798199.1.6614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]