SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37680050|ref|NP_934659.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680050|ref|NP_934659.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily YefM-like 0.00000000000000314
Family YefM-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680050|ref|NP_934659.1|
Sequence length 80
Comment hypothetical protein VV1866 [Vibrio vulnificus YJ016]
Sequence
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDAVVVMSIKDYEELEAMKADYLRHCFES
AKQDLAQGDVVDGEDFLNAL
Download sequence
Identical sequences A0A0A5JS34 A0A0M0HIB8 D0HCG1 Q7MKD6
WP_000557294.1.10640 WP_000557294.1.19647 WP_000557294.1.20403 WP_000557294.1.33883 WP_000557294.1.33980 WP_000557294.1.340 WP_000557294.1.34622 WP_000557294.1.40386 WP_000557294.1.45334 WP_000557294.1.50461 WP_000557294.1.5283 WP_000557294.1.60037 WP_000557294.1.66844 WP_000557294.1.81555 WP_000557294.1.81753 WP_000557294.1.85177 gi|37680050|ref|NP_934659.1| 196600.VV1866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]