SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680076|ref|NP_934685.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37680076|ref|NP_934685.1|
Domain Number - Region: 83-116
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00085
Family DNA primase zinc finger 0.063
Further Details:      
 
Domain Number - Region: 27-72
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0396
Family SPRY domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680076|ref|NP_934685.1|
Sequence length 117
Comment hypothetical protein VV1892 [Vibrio vulnificus YJ016]
Sequence
MFTRWIVDMDEKVQVAFGVWAGVSLLGYVLFYANKNTQFKRKYYPAFSVVTGALFLFIVN
LMGFFKHQFWIVIVPIVALITFMNIRGAKFCDNCGKSNFTQSLQDRKIECQKCGHTI
Download sequence
Identical sequences Q7MKB3
196600.VV1892 gi|37680076|ref|NP_934685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]