SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680110|ref|NP_934719.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680110|ref|NP_934719.1|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000628
Family Toll/Interleukin receptor TIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680110|ref|NP_934719.1|
Sequence length 171
Comment hypothetical protein VV1926 [Vibrio vulnificus YJ016]
Sequence
MQHDLNNEVLMKIFWSYAKRDDAKPNHVTQLRNQFEIVASQCLGDDIDIFQDVTGLTWGS
EWRQTLENEVKQADIFVCILSPSYFNSKMCIQEVVWAMEANVRIHPILYRACPKGFASQF
SDSDRDAVILNSASTEVVDKYQYADFTRLRNRAKDSTEVLDFLDGICEQIA
Download sequence
Identical sequences Q7MK82
WP_011150488.1.34622 WP_011150488.1.4651 gi|37680110|ref|NP_934719.1| 196600.VV1926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]