SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680284|ref|NP_934893.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680284|ref|NP_934893.1|
Domain Number 1 Region: 146-275
Classification Level Classification E-value
Superfamily CBS-domain pair 1.1e-25
Family CBS-domain pair 0.0007
Further Details:      
 
Domain Number 2 Region: 5-135
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-25
Family cAMP-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680284|ref|NP_934893.1|
Sequence length 625
Comment signal-transduction protein [Vibrio vulnificus YJ016]
Sequence
MEAELSDILHFLSLHSPFSELPHETLEYVAHHIEIGYYRSQTPIINAGDEIHELFLVRSG
VVEVYRRNGELYNRLDEGALFGQMGLLTNNRVRFPVTAIKDCLVYTIPEAIFQQLYEQHD
CFADFVEVEQTTRLRQAVKGVNEANDLTTSKVRTLLNRTAPTIDASATIQTAAQRMADEQ
VSSLLVLQTADEENRDPIAGIVTDRDLCTRVVAQGKSPNEAVASVMTPQVIRLDHNAYVY
EAMLTMLRHNVHHLPILQGDRLLGIIEATDIVRYESQNSLLLVSRIFQQQSFEGLAQIAQ
EVKASFVRLVNEDANSHMVGSAMSVIGRSFKQRIIELAEEELGPPPIRYCFLALGSMGRD
EQLLVTDQDNAIILDDSYQESVHGQYFEQLAHIVCDALNECGYQYCTGDIMATNPIWRMT
KAQWRDCFADWIDDPNPKALLNASIFFDLDGVSGQVAWADQLTEFVVKRAKGNPRFLACL
ARNALNRTPPLGFFKDFVMEKDGRHNNSINLKRRGTAPLADLIRVHALAVGSTAKNSFER
LDDIIDAGILPKGRAQNLKDALEFISMVRIRHQAIDVANDNEPDNNIEPENLSDFERRTL
KDAFQILSNAQNFLKFRYQASSHFK
Download sequence
Identical sequences A0A1W6M4W7 Q7MJR0
WP_011150628.1.34622 WP_011150628.1.93668 196600.VV2100 gi|37680284|ref|NP_934893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]