SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37680296|ref|NP_934905.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37680296|ref|NP_934905.1|
Domain Number - Region: 11-67
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00379
Family ABC transporter transmembrane region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680296|ref|NP_934905.1|
Sequence length 222
Comment hypothetical protein VV2112 [Vibrio vulnificus YJ016]
Sequence
MQTLQLSNRYQLASSVFVKGLMVVFAIVGALILLLSPSWPQALLSVGLLITVALFGAYLI
QRSTVAYTLTPTHFQQHLFQGGWVVKWKNIEKIGICTYESEGWHQPLPWIGIKLVHYSPY
LMAICPRVSTEILLSQRALLYLGARQHQCESQFEEMVLDPQPYIDEQGKEHTGLQAMLAN
RMKYQRRFFDYDIFISAQDLDREAEEFVGLARRYLAAAEPDQ
Download sequence
Identical sequences Q7MJP9
WP_011150633.1.34622 196600.VV2112 gi|37680296|ref|NP_934905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]