SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37680305|ref|NP_934914.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680305|ref|NP_934914.1|
Domain Number 1 Region: 95-153,194-286
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.41e-57
Family GntR ligand-binding domain-like 0.0000265
Further Details:      
 
Domain Number 2 Region: 28-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.02e-16
Family GntR-like transcriptional regulators 0.0000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680305|ref|NP_934914.1|
Sequence length 295
Comment fatty acid metabolism regulator [Vibrio vulnificus YJ016]
Sequence
MMSAIRPKTNIGITNIMVIKAKSPAGFAEKYIIESIWNGRFPPGSILPAERELSELIGVT
RTTLREVLQRLARDGWLTIQHGKPTKVNQFMETSGLHILDTLMTLDVDNATNIVEDLLAA
RTNISPIFMRYAFKVNKENSERTIKTVIDSCEQLVAAESWDAFLSSSPYADKIQQNVKED
NEKDEAKRQEILIAKTFNFYDYMLFQRLAFHSGNQIYGLIFNGLKKLYDRVGSFYFSNPA
SRELALKFYRQLLLTCESGQREQLPALIRQYGIESAMIWNEMKKQLPTNFTEDDC
Download sequence
Identical sequences 196600.VV2121 gi|37680305|ref|NP_934914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]