SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680326|ref|NP_934935.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680326|ref|NP_934935.1|
Domain Number 1 Region: 428-668
Classification Level Classification E-value
Superfamily EAL domain-like 1.27e-64
Family EAL domain 0.0014
Further Details:      
 
Domain Number 2 Region: 132-244
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-17
Family Heme-binding PAS domain 0.057
Further Details:      
 
Domain Number 3 Region: 693-823
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000316
Family CBS-domain pair 0.0039
Further Details:      
 
Weak hits

Sequence:  gi|37680326|ref|NP_934935.1|
Domain Number - Region: 262-413
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00275
Family GGDEF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680326|ref|NP_934935.1|
Sequence length 826
Comment hypothetical protein VV2142 [Vibrio vulnificus YJ016]
Sequence
MAWSWPMDEKLVGSSSEVQAHENVIGVAFDWRLNFVTQRFECEESAAYALFGVEIFPITT
KQLIQWLPISQRKKAIDAFRQVLTTGVSQRYQCALVTPLNIVTFVEFDIERQEENQLAGT
VTPLLLLRDADEVAELFYRLFENDHHGILVTDEETRILACNAYFERLTGYHRRDLIGLKS
RIFNADKHSEHFYQSMWHALATEGSWSGAILTRTSGGENTPQDLTIQKVTLAGRDYFIGF
SADLSTHLNRLNDREKGGIDLLTQLPSKEKFLRLLEVWHQSESDKSTLLLLAIQPNFSYS
TELNAKREFAQFLFEHSHNHLVGYLGNDRFVVGLEIEHHSHISLIRQVRQRMKRFFHGFK
QAKGEVSQALTQGKTGVSVLGVDAKTPAALFTHANQALLEMHSGQQRHISFYDHAMHLQI
EKKKRLETLLLECIEQKTIEVHYQPIIDLQQWRVDKFEALCRFPPALSQEASVQELINIA
EDLDMIEILDQQVARQALSDLEYLQCCFGPQVGISFNRSISSSTGVSQLLMQTALLIDES
GVQPDQVTVEITENAYFESEEHKADGLKLLRKAGVSVAVDDFGTGYSSFQYLTQCHFDVL
KIDRAFVQNIRVNSNQYRIVRSLTELSHQLGLRVVAEGVESETELQILAQIGVDSVQGYF
FAKPFALKSDAQQQFEALSFASYQKKYGSKGCVCDLATPATPHLDPGDPISLAFEYLQRD
ELNIIPVVDGRKCVGFVDREAMNLHLTPGMGTELETMKEAGLWNKRVNQVMVLNFSTLHW
HTQMSALAVVINQLELFPWIMVDDDGDYKGVIEMHSVLKHLRKNLS
Download sequence
Identical sequences Q7MJL9
gi|37680326|ref|NP_934935.1| 196600.VV2142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]