SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680357|ref|NP_934966.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37680357|ref|NP_934966.1|
Domain Number - Region: 137-223
Classification Level Classification E-value
Superfamily Clc chloride channel 0.051
Family Clc chloride channel 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680357|ref|NP_934966.1|
Sequence length 256
Comment hypothetical protein VV2173 [Vibrio vulnificus YJ016]
Sequence
MLELFLQPETWVIFATLFALEIVLGVDNVVFISVLCERLPVEQRKFARNMGISLAVSARI
VLVFSISWVMSLTQPILSFQDVEFTGRDVIMIAGGAFLLAKSAKELWSWLTQHEHAHSTH
VRTGLAVVLLQIVAVDAVFSMDSVITAVGLTNEVPIMVAAILASAVVMVLTAEKINHVVT
KYPGFKTLALLFLILLGGLLMAEGFAVHVNKGYVYFAMAFGLILELCHIQLKKKQKVNIR
RIRPLNVSIQGDLIRG
Download sequence
Identical sequences Q7MJI8
WP_011150686.1.34622 196600.VV2173 gi|37680357|ref|NP_934966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]