SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680359|ref|NP_934968.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680359|ref|NP_934968.1|
Domain Number 1 Region: 4-380
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 6.67e-126
Family Iron-containing alcohol dehydrogenase 0.000000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680359|ref|NP_934968.1|
Sequence length 382
Comment alcohol dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MAFALNLPKLSYSGVGAVDDAIATLSQQPIKRALVVTDHNLVELGILDHLFELLDEFSID
YELFDKVTPNPTATLVREGLAVYNDTGCDCFIAVGGGSPVDCAKAIRIVASNPGDIVDFD
GVGKVKSAGDFFIAINTTAGTAAEMTSNSVITDESRQVKMVIIDAKQIPDVAVNDPTLMV
NLPPHVTAATGMDALTHAVEAYVTPGAHTLTKPTALEAIKLIAQWLPIAVEDGKNLEARE
QLANAQFLAGMAFNSAGLGLVHAMAHQPGATHNLPHGVCNAILLPQVCEFNAEKYPQRFR
DIASVMGGKTEGLSDREAADLAVNLMRNLSKRVNIPSGFSLLGISRADCELWIEKALADP
CLGGNPRQPTASEVESLYLACM
Download sequence
Identical sequences Q7MJI6
WP_011150688.1.34622 WP_011150688.1.58885 WP_011150688.1.81460 196600.VV2175 gi|37680359|ref|NP_934968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]