SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680426|ref|NP_935035.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680426|ref|NP_935035.1|
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 4.6e-108
Family Malic enzyme N-domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 265-556
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.41e-88
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680426|ref|NP_935035.1|
Sequence length 559
Comment malate dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MSKKMFIRQAGNTLLNTPLLNKGSAFTLEERKNFNLIGLLPANIETIDEQVSRAYEQFSL
FNSAMEKHIYLRNIQDTNETLYFRLINQHIEEMMPIIYTPTVGEACQKFSQIYRRNRGLF
LSFEDQDELEAILNNAPNTHVKVIVITDGERILGLGDQGIGGMGIPIGKLALYTACGGIS
PEHTLPIVLDVGTNNSALLSDPMYMGWRHPRITGDQYDDFVDDCLKAIRRRWPNALIQFE
DFAQANAMPLLMRYQNQFCCFNDDIQGTASVTVGTLLAAAHATGKKLSAQKVLFAGAGSA
GCGIAEAIVAQMVSEGISVQQARSQVFMVDRWGMLEQEMPNLLPFQKPLAQPASLRTEWQ
IEANREISLLDVIQHAHPDVLIGVTGVPGLFNQEIIEAMAEDCERPVVMPLSNPTSRVEA
KPEDILMWTQGQAIVATGSPFPDVVLAGKRYPIAQCNNSYIFPGVGLGVISANAHRVTNE
MLQQASITLASLSPMLNGGNMLLPPLSEIQNVSRKIALEVAKKAVEQGKASHRTEERLLE
RIDEEFWYAQYCEYRRIAS
Download sequence
Identical sequences Q7MJC0
196600.VV2242 WP_011150752.1.34622 gi|37680426|ref|NP_935035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]