SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37680450|ref|NP_935059.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680450|ref|NP_935059.1|
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily YgfB-like 1.96e-25
Family YgfB-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680450|ref|NP_935059.1|
Sequence length 164
Comment hypothetical protein VV2266 [Vibrio vulnificus YJ016]
Sequence
MTSMAAAPNILPPNEWLPFLWGGEETAPFLDGEQLESYIDAIVNLWNQARPALIEGTWQW
PEECALDEAEIVNEATRDFCEGLLQGWQLARDDWETLMPEHSEENALLGGVLLSLTMLYD
PETTIATLSEQGFDGLDQFAEIFNAMPMMLCGLTQRGVMLADEQ
Download sequence
Identical sequences Q7MJ96
196600.VV2266 gi|37680450|ref|NP_935059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]