SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680479|ref|NP_935088.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680479|ref|NP_935088.1|
Domain Number 1 Region: 2-287,471-532
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-92
Family FAD-linked reductases, N-terminal domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 289-472
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-47
Family GMC oxidoreductases 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680479|ref|NP_935088.1|
Sequence length 546
Comment choline dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MKEYDFIVVGGGSAGCVLASRLTEDPDVTVCLLEAGGKDSSPLIHTPVGMVAMMPTKINN
WGFETIPQAGLNGRKGYQPRGKTLGGSSSINAMMYARGHRYDYDLWASLGNVGWSYDDCL
PYFKKAENNEIHRDEFHGQGGPLNVTNLRSPSDVLERYLAACESIGVPRNPDINGAQQLG
AMATQVTQINGERCSAAKAYLTPHLDRPNLTVLTQATTHKILFDGKRAVGVEYGQKGHTF
QIRCKREVILSAGAFGSPQLLLLSGVGAKKDLQPYGIQQVHSLPGVGENLQDHIDLVHTY
RCSAKRDTFGVSLRMASELTKALPQWITQRTGKMSSNFAEGIGFLCSDDSVEIPDLEFVF
VVAVVDDHARKIHASHGFSSHVTLLRPKSVGRVKLNSTNPYDVPHIDPAFFTHPEDMKIM
IKGWKKQQKMLESSAFDDIRGESFYPVDASDDKAIEQDIRNRADTQYHPVGTCKMGVASD
PLAVVDHQLRVHGLAGLRVVDASIMPTLIGANTNAPTIMIAEKIADAIKAHYAGLVCAEK
ETMPVV
Download sequence
Identical sequences Q7MJ67
196600.VV2295 WP_011150796.1.34622 gi|37680479|ref|NP_935088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]