SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680552|ref|NP_935161.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680552|ref|NP_935161.1|
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.1e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0068
Further Details:      
 
Domain Number 2 Region: 165-347
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.22e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680552|ref|NP_935161.1|
Sequence length 429
Comment NADH dehydrogenase, FAD-containing subunit [Vibrio vulnificus YJ016]
Sequence
MTRIIVVGGGAGGLELATKLGRTLGRKRRAQITLVDRKASHLWKPLLHEVATGSLDEGVD
ALSYRAHAKNHCFDFQMGSLENIDRERKVVILSELKDEHGELLMPSRELEYDLLVLAIGS
TSNDFNTPGVREHCIFLDSPEQAHRFRHEMNNQFLKLHAKNGHGTVDIAIVGAGATGVEL
SAELHNAIKELRTYGFGDLDSSKLNVNLVEAGERILPALPPRISSAAHSELVKLGVNVRT
ATMVTKAEADGLTTKDGEKIPAQIMVWAAGIKAPDFMKDIAGLETNRINQLVVKNTLQTT
RDDDIFVIGDLAQCTQADGKFVPPRAQAAHQMASHAFSNIIAKLNGRELKDYVYKDHGSL
VSLSRFSTVGSLMGNLTKGSMMVEGRIARVVYISLYRMHQMALHGIFKTGLMMLVGRINR
VLRPNLKLH
Download sequence
Identical sequences A0A1V8MIB1 Q7MIZ5
WP_011150843.1.13374 WP_011150843.1.24453 WP_011150843.1.28215 WP_011150843.1.28571 WP_011150843.1.30871 WP_011150843.1.34622 WP_011150843.1.39407 WP_011150843.1.43691 WP_011150843.1.47396 WP_011150843.1.49981 WP_011150843.1.512 WP_011150843.1.53782 WP_011150843.1.54603 WP_011150843.1.553 WP_011150843.1.58875 WP_011150843.1.59451 WP_011150843.1.60167 WP_011150843.1.61535 WP_011150843.1.63462 WP_011150843.1.63825 WP_011150843.1.65015 WP_011150843.1.66219 WP_011150843.1.67868 WP_011150843.1.81555 WP_011150843.1.86005 WP_011150843.1.86748 WP_011150843.1.95941 WP_011150843.1.96968 gi|37680552|ref|NP_935161.1| 196600.VV2368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]