SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680563|ref|NP_935172.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680563|ref|NP_935172.1|
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-30
Family CBS-domain pair 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680563|ref|NP_935172.1|
Sequence length 138
Comment inosine monophosphate dehydrogenase-related protein [Vibrio vulnificus YJ016]
Sequence
MNSLKVKDYMTLQAVTFTVDMSLSAALNKVMKSVVMGGPVINEKEEVIGFLSEQDLLDKL
VKASYHCQDSYTVGECMHSDVLSVSSDMSIIELADMMKVGKPKMYPVVDNKKLVGVITRR
DVLKAIGQSLDDCFKHPV
Download sequence
Identical sequences A0A087IQ06 A0A0H0Y350 A0A1L9L7F3 Q7MIY4
196600.VV2379 216895.VV1_2062 WP_011079950.1.17874 WP_011079950.1.21633 WP_011079950.1.22486 WP_011079950.1.22778 WP_011079950.1.24453 WP_011079950.1.25536 WP_011079950.1.28571 WP_011079950.1.30871 WP_011079950.1.31968 WP_011079950.1.33883 WP_011079950.1.34622 WP_011079950.1.39524 WP_011079950.1.43691 WP_011079950.1.47396 WP_011079950.1.49981 WP_011079950.1.53345 WP_011079950.1.54603 WP_011079950.1.55006 WP_011079950.1.58875 WP_011079950.1.58885 WP_011079950.1.59048 WP_011079950.1.59451 WP_011079950.1.60167 WP_011079950.1.60868 WP_011079950.1.61535 WP_011079950.1.63462 WP_011079950.1.66219 WP_011079950.1.66581 WP_011079950.1.73066 WP_011079950.1.73173 WP_011079950.1.78668 WP_011079950.1.79678 WP_011079950.1.81460 WP_011079950.1.81555 WP_011079950.1.82587 WP_011079950.1.8379 WP_011079950.1.84562 WP_011079950.1.86005 WP_011079950.1.90288 WP_011079950.1.93668 WP_011079950.1.94371 WP_011079950.1.95941 WP_011079950.1.96968 WP_011079950.1.9921 gi|27365396|ref|NP_760924.1| gi|320155782|ref|YP_004188161.1| gi|37680563|ref|NP_935172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]