SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680575|ref|NP_935184.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680575|ref|NP_935184.1|
Domain Number 1 Region: 123-280
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.08e-50
Family Aminoacid dehydrogenase-like, C-terminal domain 0.000000628
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.25e-39
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.00000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680575|ref|NP_935184.1|
Sequence length 285
Comment bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Vibrio vulnificus YJ016]
Sequence
MTAQNIDGTLISQTVRSEVAARVKARVAAGLRAPGLAVVLVGEDPASQVYVGSKRRACEE
VGFVSKSFDLPASTSEEELLALIDELNNDAEIDGILVQLPLPAGIDSTHVLESIHPEKDV
DGFHPYNVGRLAQRIPKLRSCTPKGIITLLERYNIALRGKHAVIVGASNIVGRPMTLELL
LAGCTTTTCHRFTKDLEGHVRQADVLVVAVGKPNFIPGEWVKEGAIVVDVGINRLESGKL
IGDVEYNKARERASFITPVPGGVGPMTVASLIENTMLACEQYHTK
Download sequence
Identical sequences A0A087JL20 A0A0H0Y7E8 Q7MIX2 Q8DB06
gi|37680575|ref|NP_935184.1| gi|320155750|ref|YP_004188129.1| WP_011079917.1.100126 WP_011079917.1.13374 WP_011079917.1.16238 WP_011079917.1.17874 WP_011079917.1.21633 WP_011079917.1.22486 WP_011079917.1.22778 WP_011079917.1.24453 WP_011079917.1.28215 WP_011079917.1.28571 WP_011079917.1.30871 WP_011079917.1.31968 WP_011079917.1.33883 WP_011079917.1.34622 WP_011079917.1.39407 WP_011079917.1.39524 WP_011079917.1.43691 WP_011079917.1.47396 WP_011079917.1.49981 WP_011079917.1.512 WP_011079917.1.53782 WP_011079917.1.54486 WP_011079917.1.54603 WP_011079917.1.54858 WP_011079917.1.55006 WP_011079917.1.553 WP_011079917.1.58875 WP_011079917.1.58885 WP_011079917.1.59022 WP_011079917.1.59048 WP_011079917.1.60167 WP_011079917.1.60868 WP_011079917.1.61535 WP_011079917.1.63462 WP_011079917.1.63825 WP_011079917.1.65015 WP_011079917.1.66219 WP_011079917.1.66581 WP_011079917.1.67868 WP_011079917.1.73066 WP_011079917.1.73173 WP_011079917.1.78369 WP_011079917.1.78668 WP_011079917.1.79678 WP_011079917.1.81060 WP_011079917.1.82587 WP_011079917.1.8292 WP_011079917.1.8379 WP_011079917.1.84562 WP_011079917.1.86005 WP_011079917.1.86748 WP_011079917.1.89979 WP_011079917.1.90288 WP_011079917.1.93668 WP_011079917.1.95941 WP_011079917.1.96968 WP_011079917.1.9921 WP_011079917.1.99976 gi|27365363|ref|NP_760891.1| 196600.VV2391 216895.VV1_2022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]