SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37680609|ref|NP_935218.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680609|ref|NP_935218.1|
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.44e-93
Family Pseudouridine synthase I TruA 0.00000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680609|ref|NP_935218.1|
Sequence length 264
Comment tRNA pseudouridine synthase A [Vibrio vulnificus YJ016]
Sequence
MRIALGIEYNGTDYFGWQRQREVASVQEKLEKALSKVANHPVEVQCAGRTDAGVHGTGQV
VHFDTNVERKMVAWTMGANANLPKDIAVRWAKAVPDEFHARFSATARRYRYIIFNHALRP
GILGSGVSHYHGELDEKKMHEAGQYLLGENDFTSFRAVQCQSLSPFRNMIHLNVTRHGHY
VVIDIKANAFVHHMVRNITGSLIMVGRGEQDPEWIKWLLEAKDRKLAGPTAKAEGLYLVD
VDYPEEFDLPRESIGPLFLPDNLN
Download sequence
Identical sequences A0A0H0Y379 A0A1L9L5K8 A0A1V8MVW0 Q7M7J4 Q8CWK3
gi|320155720|ref|YP_004188099.1| 196600.VV2425 216895.VV1_1992 gi|37680609|ref|NP_935218.1| gi|27365335|ref|NP_760863.1| WP_011079889.1.17874 WP_011079889.1.21633 WP_011079889.1.22778 WP_011079889.1.25536 WP_011079889.1.34622 WP_011079889.1.39524 WP_011079889.1.53345 WP_011079889.1.54486 WP_011079889.1.66581 WP_011079889.1.73066 WP_011079889.1.79678 WP_011079889.1.82587 WP_011079889.1.8379 WP_011079889.1.93668 WP_011079889.1.94371 WP_011079889.1.9921 WP_011079889.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]