SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680614|ref|NP_935223.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680614|ref|NP_935223.1|
Domain Number 1 Region: 266-481,574-663
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.71e-27
Family FAD-linked reductases, N-terminal domain 0.069
Further Details:      
 
Weak hits

Sequence:  gi|37680614|ref|NP_935223.1|
Domain Number - Region: 482-552
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00353
Family D-aminoacid oxidase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680614|ref|NP_935223.1|
Sequence length 672
Comment 5-methylaminomethyl-2-thiouridine methyltransferase [Vibrio vulnificus YJ016]
Sequence
MTSITHAELGWNEVGTPVSDQFDDVYFSNVNGLEETRYVFLKQNLIPERWQEFDRRRFVI
GETGFGTGLNFLAVWQAFNDFRRANPDATLKELHFISFEKFPLSKQDLIKAHQAWPELAE
LAEKLHRHYPPAVPECHRIVLDNGAVTLDLWLGDIKDCLPSVPYGEEGIIDTWFLDGFAP
SKNPEMWNQDLFNGMAKLARSECRVATFTSAGFVRRGLIEAGFAMKKVKGFGTKREMIAG
CMETRQPQSRHAPYFNRTSASHLDSIAIIGGGIASAALAKALVQRGQKVTLYCKHAQAAE
GASGNRQGAVYPLLNGSHDGVSRVFAPAFLFTRQFVEQAAQALTFDHDWCGVTQLMWDEK
STNKLDKMLSGNFAPELIQKLSAEETAAKIGLPIDMASVHYPLGGWLCPAELTQALFAQL
DTLDNFTAKFEQSVEQLIWDERSQQWQVHTQGQHDTYSAVVIANGHEFQTFSQTADIPLG
QVKGQVSHAPATETLSKLKSVLCYDGYMTPVNPNNQHLCIGASYDRRHLDTEFDVNAQQE
NAEKLTQCVPNQAWAKEVDTSGNLSRQGIRCVSRDHLPFVGNVGDFSAIKRQYADLPHTQ
AEEIEVISQFPNLFCLLGLGSRGLSSAPLMAELLASQICNDPLPLPVDVLEELHPSRMWV
RKLRKGKAITEL
Download sequence
Identical sequences Q7MIT5
WP_011150886.1.34622 gi|37680614|ref|NP_935223.1| 196600.VV2430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]