SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680624|ref|NP_935233.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680624|ref|NP_935233.1|
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.9e-67
Family Crotonase-like 0.0000205
Further Details:      
 
Domain Number 2 Region: 313-491
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.89e-46
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000458
Further Details:      
 
Domain Number 3 Region: 610-704
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.55e-27
Family HCDH C-domain-like 0.00025
Further Details:      
 
Domain Number 4 Region: 494-593
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.64e-27
Family HCDH C-domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680624|ref|NP_935233.1|
Sequence length 705
Comment multifunctional fatty acid oxidation complex subunit alpha [Vibrio vulnificus YJ016]
Sequence
MSEQKAFNLKIDEQNIAWLGIDVPNEKMNTLQAAFADEMKAIFAQLKDSSGLKGLIVHSL
KPDNFVAGADVRMLEACKTAPEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDFRVCSDDDATRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPQTILLDVAKQFVEKGKKRAKQKVTTKEKLLSGSGLGRKFVFEQAAKKTHE
KTRGNYPATVAILQVIQHGLEKGMKQGLELEAKRFGELVMSNESKALRSIFFATTEMKKE
TGSEAKPSKVGMVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALKYNYKLFDK
QRKRRILSKAQLQSKMLQLSGGTDFTSFNRTDVVIEAVFEDLSLKQQMVADIEANAKPET
IFATNTSSLPIHKIAEKAQRPENIVGLHYFSPVEKMPLVEVIPHESTSEETIATVVALAK
KQGKTPIVVKDQAGFYVNRILAPYMNESAHILLANEPIDKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVAELGARFKGPDVFDVLLNDGRKGRKSGKGFYTYKGKKKEVDKSVYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNQFAEKYGDRFAPCDGLLTRAGEGRRFYDN
Download sequence
Identical sequences A0A0H0XU43 A0A1W6M5Q8 Q7MIS5
gi|37680624|ref|NP_935233.1| 196600.VV2440 WP_011150894.1.22486 WP_011150894.1.25536 WP_011150894.1.33883 WP_011150894.1.34622 WP_011150894.1.55006 WP_011150894.1.58885 WP_011150894.1.66581 WP_011150894.1.73066 WP_011150894.1.79678 WP_011150894.1.90288 WP_011150894.1.93668 gi|320155705|ref|YP_004188084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]