SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680671|ref|NP_935280.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680671|ref|NP_935280.1|
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Flagellar export chaperone FliS 2.62e-39
Family Flagellar export chaperone FliS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680671|ref|NP_935280.1|
Sequence length 136
Comment flagellar protein FliS [Vibrio vulnificus YJ016]
Sequence
MRGSLQAYKKVSVDSQLSAASPHKVIQMLMAGAIERLIQGKAAMQAGNIPVKGERLGKAL
DIIIALRSCLSMDDGGDIARNLDQLYEFMITQISGANHKNDPQMIDDVIDIIREIKSAWD
QIPNEYHNLTAADIGM
Download sequence
Identical sequences A0A087IW03 A0A0H0XUB2 A0A1L9L551 Q7MIM9
196600.VV2487 216895.VV1_1930 WP_011079829.1.100126 WP_011079829.1.13374 WP_011079829.1.16238 WP_011079829.1.17874 WP_011079829.1.21633 WP_011079829.1.22486 WP_011079829.1.22778 WP_011079829.1.24453 WP_011079829.1.25536 WP_011079829.1.28215 WP_011079829.1.28571 WP_011079829.1.30871 WP_011079829.1.31968 WP_011079829.1.33883 WP_011079829.1.34622 WP_011079829.1.39407 WP_011079829.1.39524 WP_011079829.1.43691 WP_011079829.1.47396 WP_011079829.1.512 WP_011079829.1.53345 WP_011079829.1.53782 WP_011079829.1.54486 WP_011079829.1.54603 WP_011079829.1.54858 WP_011079829.1.55006 WP_011079829.1.553 WP_011079829.1.58875 WP_011079829.1.58885 WP_011079829.1.59022 WP_011079829.1.59048 WP_011079829.1.59451 WP_011079829.1.60167 WP_011079829.1.60868 WP_011079829.1.61535 WP_011079829.1.63462 WP_011079829.1.63825 WP_011079829.1.65015 WP_011079829.1.66219 WP_011079829.1.66581 WP_011079829.1.67868 WP_011079829.1.73066 WP_011079829.1.73173 WP_011079829.1.78369 WP_011079829.1.78668 WP_011079829.1.79678 WP_011079829.1.81060 WP_011079829.1.81460 WP_011079829.1.81555 WP_011079829.1.82587 WP_011079829.1.8292 WP_011079829.1.8379 WP_011079829.1.84562 WP_011079829.1.86005 WP_011079829.1.86748 WP_011079829.1.89979 WP_011079829.1.90288 WP_011079829.1.93668 WP_011079829.1.94371 WP_011079829.1.95941 WP_011079829.1.96968 WP_011079829.1.9921 WP_011079829.1.99976 gi|320155659|ref|YP_004188038.1| gi|27365275|ref|NP_760803.1| gi|37680671|ref|NP_935280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]