SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680699|ref|NP_935308.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680699|ref|NP_935308.1|
Domain Number 1 Region: 172-342
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 8.07e-61
Family PurM C-terminal domain-like 0.000000468
Further Details:      
 
Domain Number 2 Region: 8-171
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.94e-54
Family PurM N-terminal domain-like 0.0000000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680699|ref|NP_935308.1|
Sequence length 346
Comment phosphoribosylaminoimidazole synthetase [Vibrio vulnificus YJ016]
Sequence
MSGNNSSLSYKDAGVDIDAGNALVERIKGSVKRTRRPEVMGGIGGFGALCELPTKYKQPV
LVSGTDGVGTKLRLALDMNKHDTIGIDLVAMCVNDLIVQGAEPLFFLDYYATGKLDVDVA
ADVISGIAEGCIQAGCALIGGETAEMPGMYEGEDYDVAGFCVGVVEKEDIIDGTKVAVGD
ALIAVGSSGPHSNGYSLVRKILEVSGADKNEELAGRTIGEHLLEPTKIYIKSALKMIEQH
DIHAISHITGGGFWENIPRVLPEGTKAVIDGKSWEWPVIFQWLQEKGNVATREMYRTFNC
GVGLIVALPQDQAEAAVALLQQEGEKAWVIGAIAQAEAGEEQVEIN
Download sequence
Identical sequences A0A1L9L584 A0A1V8MVJ6 Q7MIK1 Q8DBC2
gi|27365246|ref|NP_760774.1| WP_011079800.1.13374 WP_011079800.1.16238 WP_011079800.1.17874 WP_011079800.1.21633 WP_011079800.1.22778 WP_011079800.1.28571 WP_011079800.1.30871 WP_011079800.1.34622 WP_011079800.1.39407 WP_011079800.1.39524 WP_011079800.1.47396 WP_011079800.1.53345 WP_011079800.1.53782 WP_011079800.1.54486 WP_011079800.1.553 WP_011079800.1.58875 WP_011079800.1.58885 WP_011079800.1.73173 WP_011079800.1.81460 WP_011079800.1.82587 WP_011079800.1.86748 WP_011079800.1.93668 WP_011079800.1.94371 WP_011079800.1.96968 WP_011079800.1.99976 gi|37680699|ref|NP_935308.1| 196600.VV2515 216895.VV1_1900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]