SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680743|ref|NP_935352.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680743|ref|NP_935352.1|
Domain Number 1 Region: 33-172
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.45e-19
Family DNA polymerase beta-like 0.067
Further Details:      
 
Domain Number 2 Region: 416-593
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000000534
Family HD domain 0.052
Further Details:      
 
Domain Number 3 Region: 187-310
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000000051
Family Glutamine synthase adenylyltransferase GlnE, domain 2 0.019
Further Details:      
 
Domain Number 4 Region: 689-762
Classification Level Classification E-value
Superfamily ACT-like 0.0000000763
Family IlvH-like 0.088
Further Details:      
 
Domain Number 5 Region: 796-854
Classification Level Classification E-value
Superfamily ACT-like 0.000000382
Family SP0238-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680743|ref|NP_935352.1|
Sequence length 873
Comment PII uridylyl-transferase [Vibrio vulnificus YJ016]
Sequence
MAFQSPLTFNDEQLTVAQLKSQLDLFANAQKQAFLNHHPVTDLVLSRAEYMDLLLTRLWR
YYGFSEIHNISLVAVGGYGRGELHPLSDIDILVLSKHKLPGELETKLSEFITLLWDLRLE
VGHAVRTVEECAAIGREDLTVATNLQEARLLCGSENTFQDLKKVVLSDSFWPSETFYRAK
IQEQRERHARYHDTTYNLEPDIKSTPGGLRDIHTLSWVARRHFGATSLLEMSRYGFLTDA
EYRELVECQDFLWRVRFALHIELKRYDNRLTFAHQIQVAEHLGFKGEGNRGIEMMMKEFY
RTLRRVAELNKMLLKLFDQAIINGGETEPAVIINEDFQRRGRLIEARKPALFQARPETIL
DMFLHIANDSTIDSVSPPTLRQLRTARRRLNKFLHTIPEAREKFMELVRHPNALHRAFSL
MHKLGVLAAYLPQWSQIVGQMQFDLFHVYTVDEHSVRLLNHINTFSYAKNHDKHPICCEV
YPRLQKKELLLLAAIFHDIGKGRGGDHSEIGEKEAYDFCIEHGLSKPEAKLVSWLVRHHL
LMSVTAQRRDIYDPEVITEFAKQVRDEERLEYLVCLTVADICATNPELWNSWKRTLLAEL
FYSTQRALRRGLENPVDVRERIRHNQQLASALLRKEGFTAREIEVLWQRFKADYFLRHTH
KQIAWHCEHILRMDNPEQPLVLMSKKATRGGTEVFVYTKDQHALFATVVAELDRRNFNVH
DAQIMSSKDGYVLDTFMVLDQHGQAIDVDNHKAVIKHLMHVLTDGRPTKVKTRRTPYKLQ
HFKVKTKVDFLPTKSKKRTLMELVALDTPGLLAITGATFADMGFNLHGAKITTIGERAED
LFILTSENGGRLSEEQELQLREKLIHNIAELAP
Download sequence
Identical sequences A0A0H0Y5E5 A0A1V8MV05 Q7MIF8
WP_011150965.1.21633 WP_011150965.1.22486 WP_011150965.1.22778 WP_011150965.1.28215 WP_011150965.1.34622 WP_011150965.1.39524 WP_011150965.1.54486 WP_011150965.1.79678 WP_011150965.1.81460 WP_011150965.1.82587 WP_011150965.1.90288 WP_011150965.1.99976 196600.VV2559 gi|37680743|ref|NP_935352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]