SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680762|ref|NP_935371.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680762|ref|NP_935371.1|
Domain Number 1 Region: 526-837
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.88e-49
Family Type II chitinase 0.00083
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000011
Family Carbohydrate binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680762|ref|NP_935371.1|
Sequence length 850
Comment chitinase [Vibrio vulnificus YJ016]
Sequence
MERKMRVTLLSSALISALGVSYQAQAYNCQSLATWNSSEIYTSGSQVQKENQAFEAAYWT
QGNDPVTNSGPWEAWKSLGQCDHGGGNLPPSITFSSPTNNAEIPEGAVITLLANASDEDG
QVSQVEFLAGTQLIAVVTQAPFETPWTAVKGTSQLTAIATDNEGATQSTNVNISVLPQGE
LAPPTVSLTSPTGSETLSDKDSLIVSAQAADSDGIVTQVEFFIDNQSVFVDTNAPYEYLW
NAVAGTHTFKAQATDDANLTTMSQNVSLVVSGSHSGGCADAVPYLAGTRYEAGTLVSNLN
QKYRCDVAGWCSSDAAWAYEPGVGQYWQDAWSGLGACSTPPQITITSPNDGAVVLAGSSL
TLSADASDADGSVTQVEFFANNSSLGVVTQPPYAQTWSATFVGANQLKAIATDNDNNVSE
SVVNVTVSDQALVVTLTSPTAGQTVGLGKNVTLSADATSLTSAIKQVDFVVNGSVIATDN
SAPYSVSWTPAAIGNFSVSAQAVDLAGNQALSEAAAIKVVEQSEKRHKLIGYWHNFVNGA
GCPIRLADMSNAWDVIDIAFAENDRNSNGTVHFNLYSGDIYSSCAPLDPLQFKQDMAALQ
AQGKKFVLSLGGAEGTITLNTDQDEANFVSSLTELIKEWGFDGLDVDLESGSNLVHGSQI
QARLGRALLQIEQNIGGDMYLTMAPEHPYVQGGMVAYSGIWGAYIPVINATRSTLDLLHV
QLYNNGGLPNPYLPGAAPEGSVDMMVAQSKMLIEGFELADGTRFEPLRDDQVAIGLPSGP
SSANSGQAPTQNILDALDCLTLGTKCSTVKPAFNYPNFGGVMTWSINWDKHDGFNFSKPV
GDKLTQMNAR
Download sequence
Identical sequences Q7MID9
196600.VV2578 gi|37680762|ref|NP_935371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]