SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680786|ref|NP_935395.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680786|ref|NP_935395.1|
Domain Number 1 Region: 3-166
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.4e-55
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.16e-35
Family Ketopantoate reductase PanE 0.000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680786|ref|NP_935395.1|
Sequence length 297
Comment 2-dehydropantoate 2-reductase [Vibrio vulnificus YJ016]
Sequence
MVNILILGPGAVGSLWATKLKLAGHNVALWGRSDASEQPLQLDDSSAMTFKHRHLPSLQS
ADLILVTVKAWQVMAAIEPLLPHIHSDTIILLMHNGMGTASQVEEKLTHNPIIVATTTHG
AYKPHSQQVLHTGQGITQLGGFNAQGAQCEFLQAVLDHALPSVTWNPNIQQALWTKLAIN
CAINPLTAIHQCKNGELDDERFHQLLERITQELVDVMVEEGIEVTFDTLQQTIMNVIHAT
AENYSSMRQDVFHQRRTEIDYITGYLLQAAHKHQIDAAENAKLYQHIKQIEQSWTEQ
Download sequence
Identical sequences Q7MIB5
196600.VV2602 WP_011150996.1.34622 gi|37680786|ref|NP_935395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]