SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680852|ref|NP_935461.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680852|ref|NP_935461.1|
Domain Number 1 Region: 3-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-99
Family G proteins 0.000000029
Further Details:      
 
Domain Number 2 Region: 476-596
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.09e-40
Family Translational machinery components 0.0000452
Further Details:      
 
Domain Number 3 Region: 261-399
Classification Level Classification E-value
Superfamily Translation proteins 5.52e-32
Family Elongation factors 0.00024
Further Details:      
 
Domain Number 4 Region: 600-689
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.34e-29
Family EF-G/eEF-2 domains III and V 0.00031
Further Details:      
 
Domain Number 5 Region: 401-478
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.99e-21
Family EF-G/eEF-2 domains III and V 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680852|ref|NP_935461.1|
Sequence length 695
Comment elongation factor G [Vibrio vulnificus YJ016]
Sequence
MADLSKYRNIGIFAHVDAGKTTTTERILKLTGKIHRLGEVHDGASTMDFMDQEAERGITI
QSAATTCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFCGSGGVEPQSETNWRYA
NESEVSRLIFVNKLDRMGADFFRVVEQVKKVLGANPLVMTLPIGREDEFVGVVDVLTRQA
FVWDDSGLPENYEIKEIPADMVDQVEEYREMMIESAVEQDDELMMAYMEGEEPSIEQIKA
CIRKGTRDLAFFPTYCGSAFKNKGMQLVLDAVVDYLPSPTEVEPQPLTNPETGEPTGEVA
TVSVDAPLKALAFKIMDDRFGALTFIRIYSGRLKKGDTVLNSATGKTERIGRMVEMHAND
RNELEAAQAGDIIAVVGMKNVQTGHTLCDPKHECTLEPMIFPEPVISIAVKPKDKNGSEK
MGIAIGKMVAEDPSFQVETDEDSGETILKGMGELHLDIKVDILKRTYGVELEVGAPQVAY
RETITKAVEDSYTHKKQSGGSGQFGKIDYRIKPGEPNSGFTFKSTVVGGNVPKEFWPAVE
KGFEGMMQNGVLAGFPTLDVEVELFDGGFHAVDSSAIAFEIAAKGAFRQSMPKAGPQLLE
PIMKVDVFTPEDHVGDVIGDLNRRRGMIKNQEMGATGVRVKADVPLSEMFGYIGTLRTMT
SGRGQFSMEFSHYSACPSNVAEQVIAEVKERNAKK
Download sequence
Identical sequences A0A087IP87 A0A0H0Y5Q9 A0A1L9L4N9 Q7MI49
WP_011079653.1.100126 WP_011079653.1.13374 WP_011079653.1.16238 WP_011079653.1.17874 WP_011079653.1.21633 WP_011079653.1.22778 WP_011079653.1.24453 WP_011079653.1.25536 WP_011079653.1.28215 WP_011079653.1.30871 WP_011079653.1.31968 WP_011079653.1.33883 WP_011079653.1.34622 WP_011079653.1.39407 WP_011079653.1.43691 WP_011079653.1.47396 WP_011079653.1.512 WP_011079653.1.53345 WP_011079653.1.53782 WP_011079653.1.54486 WP_011079653.1.54603 WP_011079653.1.54858 WP_011079653.1.55006 WP_011079653.1.553 WP_011079653.1.58875 WP_011079653.1.59022 WP_011079653.1.59048 WP_011079653.1.60167 WP_011079653.1.60868 WP_011079653.1.61535 WP_011079653.1.63825 WP_011079653.1.66581 WP_011079653.1.67868 WP_011079653.1.73066 WP_011079653.1.78369 WP_011079653.1.79678 WP_011079653.1.81060 WP_011079653.1.81460 WP_011079653.1.81555 WP_011079653.1.8292 WP_011079653.1.8379 WP_011079653.1.84562 WP_011079653.1.86748 WP_011079653.1.89979 WP_011079653.1.90288 WP_011079653.1.93668 WP_011079653.1.94371 WP_011079653.1.95941 WP_011079653.1.9921 WP_011079653.1.99976 gi|37680852|ref|NP_935461.1| gi|320155479|ref|YP_004187858.1| gi|326423880|ref|NP_760625.2| 196600.VV2668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]