SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680867|ref|NP_935476.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680867|ref|NP_935476.1|
Domain Number 1 Region: 10-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-85
Family G proteins 0.0000964
Further Details:      
 
Domain Number 2 Region: 262-393
Classification Level Classification E-value
Superfamily Translation proteins 7.3e-27
Family Elongation factors 0.0063
Further Details:      
 
Domain Number 3 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.6e-17
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680867|ref|NP_935476.1|
Sequence length 529
Comment peptide chain release factor 3 [Vibrio vulnificus YJ016]
Sequence
MSNAPFLSEVSKRRTFAIISHPDAGKTTITEKVLLFGRAIQTAGTVKGRGSSQHAKSDWM
EMEKERGISVTTSVMQFPYNDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVE
DRTRKLMEVTRLRDTPIVTFMNKLDRDIRDPMELLDEVESELNIACAPVSWPIGCGKEFK
GVYHIHRDETILYSTGQGHTIQEQRIIKGLDNPDLDAEVGADLAEQLREELELVLGASHE
FDQEMFLKGELTPVFFGTALGNFGVDHMLDGLTDWAPAPLPRQANERAVEATEDKFTGFV
FKIQANMDPKHRDRIAFMRIVSGTYTQGMKMNHVRLGKQVNISDAVTFMAGDRSRAEAAY
AGDIIGLHNHGTIQIGDTFTQGELLKFSGIPNFAPELFRRIRLRDPLKQKQLLKGLVQLS
EEGAVQVFRPLQNNDLIVGAVGVLQFDVVVARLKSEYNVEAIYESVNVATARWVECGDAK
KLDEFQRKNQTNLALDGGDNLTYIAPTMVNLNLAKERFPEVEFRATREH
Download sequence
Identical sequences Q7MI34
WP_011151063.1.34622 gi|37680867|ref|NP_935476.1| 196600.VV2683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]