SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680890|ref|NP_935499.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680890|ref|NP_935499.1|
Domain Number 1 Region: 9-247
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.82e-83
Family Pseudouridine synthase II TruB 0.0000000178
Further Details:      
 
Domain Number 2 Region: 250-310
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000994
Family PUA domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37680890|ref|NP_935499.1|
Sequence length 314
Comment tRNA pseudouridine synthase B [Vibrio vulnificus YJ016]
Sequence
MARRRKGRPIDGVILLDKPTGMSSNDALQKVKRLYFAEKAGHTGALDPLATGMLPICLGE
ATKFSQFLLDSDKRYRVIAKLGERTDTSDSDGDVVETRPVNVTLETLEACIEKFRGESDQ
VPSMFSALKYQGKPLYEYARKGIEVPRESRKITVYEITLHRFEGEEVEMEVHCSKGTYIR
TIVDDLGEMLGCGAHVTMLRRTGVAKYPYENMVTLEQLNELVDNANRDGVAPREVLDPLL
MPMDTAVEDLPEVNLIADLADMVMHGQAVQVLGAPTEGQLRLTMGEERRFIGVGEMNRDG
KIAPKRLVVFRDEE
Download sequence
Identical sequences Q7MI11 Q8DBV8
gi|37680890|ref|NP_935499.1| WP_011079618.1.16238 WP_011079618.1.17874 WP_011079618.1.21633 WP_011079618.1.22778 WP_011079618.1.33883 WP_011079618.1.34622 WP_011079618.1.55006 WP_011079618.1.90288 gi|27365059|ref|NP_760587.1| 196600.VV2706 216895.VV1_1698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]