SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680892|ref|NP_935501.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680892|ref|NP_935501.1|
Domain Number 1 Region: 400-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.42e-53
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 684-813
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.83e-38
Family Initiation factor IF2/eIF5b, domain 3 0.0013
Further Details:      
 
Domain Number 3 Region: 808-904
Classification Level Classification E-value
Superfamily Translation proteins 2.55e-34
Family Elongation factors 0.00004
Further Details:      
 
Domain Number 4 Region: 580-661
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-24
Family Elongation factors 0.015
Further Details:      
 
Domain Number 5 Region: 3-50
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000143
Family N-terminal subdomain of bacterial translation initiation factor IF2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680892|ref|NP_935501.1|
Sequence length 907
Comment translation initiation factor IF-2 [Vibrio vulnificus YJ016]
Sequence
MTQLTVKALSEEIGTPVDRLLEQLADAGMKKSSSDQVSDEEKQKLLTHLKKEHGDTSGDA
EPTRLTLQRKTRSTLSVNAGGGKSKDVQIEVRKKRTYVKRSAIEDEAKREAEEAAQREAE
EAAKRAAEEAAKREAEEAAKREAEEKAKREAEEAAKREAEKSVDRDAEEKAKRDAEGKAK
RDAEEKVKQEAARKEAEELKRRQEEEAKRKAEEESQRKLEEAREMAEKNKERWSAAEENK
GDMEDTDYHVTTSQYAREAEDEADRKEEEARRRKKKTKSSAKASENDERGGPRVQRGGKG
GRKGKLSKPKSMQHGFDKSAVVAKSDVVIGETIVVSELANKMSVKATEVIKIMMKMGAMA
TINQVIDQETAQLVAEEMGHKVVLRKENELEEAVLSDRDNMFEAVPRAPVVTIMGHVDHG
KTSTLDYIRRTHVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTAMRARGAQATD
IVVLVVAADDGVMPQTVEAIQHAKAAGVPLIVAVNKIDKEEANPDNVKNELSQYNVMPEE
WGGENMFVHISAKQGTNIDQLLETILLQAEVLELTAVKEGMASGVVVESRLDKGRGPVAT
VLVQSGTLRKGDIVLCGQEYGRVRAMRDEIGNEVNEAGPSIPVEILGLSGVPAAGDEATV
VRDERKAREVANYRAGKFREVKLARQQKSKLENMFSNMAAGDVAELNIVLKADVQGSVEA
IADSLTKLSTEEVKVNIVGSGVGGITETDAVLAEASNAIILGFNVRADASARRAIEAASI
DLRYYSIIYQLIDEVKQAMSGMLAPEFKQEIIGLAEVRDVFKSPKLGAIAGCMVTEGLIK
RNAPIRVLRDNVVIYEGELESLRRFKDDVAEVKNGYECGIGVKNYNDVRVGDQIEVFETI
EIKRTID
Download sequence
Identical sequences A0A1L9L4L5 Q7MI09
196600.VV2708 WP_011151080.1.21633 WP_011151080.1.22778 WP_011151080.1.34622 WP_011151080.1.53345 WP_011151080.1.94371 WP_011151080.1.9921 gi|37680892|ref|NP_935501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]