SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680907|ref|NP_935516.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680907|ref|NP_935516.1|
Domain Number 1 Region: 6-316
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.04e-98
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000276
Further Details:      
 
Domain Number 2 Region: 320-394
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000432
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680907|ref|NP_935516.1|
Sequence length 395
Comment tyrosyl-tRNA synthetase [Vibrio vulnificus YJ016]
Sequence
MASIEAALAEIKRGVEELIPEEELIAKLKEGRPLRIKLGADPTAPDIHLGHTVILNKLRA
FQDLGHDVTFLIGDFTGMVGDPTGKNSTRPPLTREDVLRNAETYKQQVFKILDPAKTKIQ
FNSEWLSELGAEGMIRLAANQTVARMLERDDFKKRYAGGQPIAIHEFMYPLLQGYDSVAM
ETDVELGGTDQKFNLLMGRELQKANGQKPQVVLMMPLLVGLDGEKKMSKSANNYIGVSEA
PSEMFGKIMSISDDLMWSYYELLSFRPLEELAQFKADVAAGKNPRDIKVLLAKEIIARFH
SEADADAAEQEFVNRFAKNQIPDEMPEFTFAAGTPMANLLKEAELCSSTSEAMRMVKQGA
AKMDGEKVEDAKAEPAVGTYVFQVGKRKFARITIA
Download sequence
Identical sequences A0A0H0Y5V0 A0A1L9L4N5 A0A1W6M6J8 Q7MHZ4 Q8DBX3
gi|320155426|ref|YP_004187805.1| gi|37680907|ref|NP_935516.1| 196600.VV2723 WP_011079602.1.16238 WP_011079602.1.17874 WP_011079602.1.21633 WP_011079602.1.22778 WP_011079602.1.24453 WP_011079602.1.25536 WP_011079602.1.28571 WP_011079602.1.30871 WP_011079602.1.34622 WP_011079602.1.47396 WP_011079602.1.53345 WP_011079602.1.54486 WP_011079602.1.58875 WP_011079602.1.58885 WP_011079602.1.59451 WP_011079602.1.60167 WP_011079602.1.66581 WP_011079602.1.73066 WP_011079602.1.79678 WP_011079602.1.81460 WP_011079602.1.8379 WP_011079602.1.93668 WP_011079602.1.94371 WP_011079602.1.9921 WP_011079602.1.99976 gi|326423868|ref|NP_760572.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]