SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680955|ref|NP_935564.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680955|ref|NP_935564.1|
Domain Number 1 Region: 1-322
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.72e-58
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000411
Further Details:      
 
Domain Number 2 Region: 343-466
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.36e-39
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37680955|ref|NP_935564.1|
Sequence length 475
Comment dihydrolipoamide dehydrogenase [Vibrio vulnificus YJ016]
Sequence
MSKEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLIERYNTLGGVCLNVGCIPSKALLHVA
KVIEEAKALAEHGIVFGEPQTDIDKIRLWKEKVINQLTGGLGGMAKMRKVNVVNGFGKFT
GPNTIEVEGEDGKTVVNFDNAIVAAGSRPIKLPFIPHEDPRIWDSTDALELKEVPGKLLI
MGGGIIGLEMGTVYHSLGSQIDVVEMFDQVIPAADKDIVKVYTKRISKKFNLMLETKVTA
VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGKLIDGEKAGLEIDERGFINVDKQ
MRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWV
GKTEKEAKAEGINYEVATFPWAASGRAIASDCADGMTKLIFDKETHRVIGGAIVGTNGGE
LLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGTITDLPNAKAKKKK
Download sequence
Identical sequences A0A087J471 A0A0H0Y467 Q7MHU6
WP_011079557.1.100126 WP_011079557.1.16238 WP_011079557.1.17874 WP_011079557.1.21633 WP_011079557.1.22486 WP_011079557.1.22778 WP_011079557.1.24453 WP_011079557.1.25536 WP_011079557.1.28215 WP_011079557.1.28571 WP_011079557.1.30871 WP_011079557.1.31968 WP_011079557.1.33883 WP_011079557.1.34622 WP_011079557.1.39407 WP_011079557.1.39524 WP_011079557.1.47396 WP_011079557.1.49981 WP_011079557.1.512 WP_011079557.1.53782 WP_011079557.1.54486 WP_011079557.1.54603 WP_011079557.1.54858 WP_011079557.1.55006 WP_011079557.1.553 WP_011079557.1.58875 WP_011079557.1.58885 WP_011079557.1.59022 WP_011079557.1.59048 WP_011079557.1.59451 WP_011079557.1.60167 WP_011079557.1.61535 WP_011079557.1.63462 WP_011079557.1.63825 WP_011079557.1.65015 WP_011079557.1.66219 WP_011079557.1.66581 WP_011079557.1.67868 WP_011079557.1.73066 WP_011079557.1.73173 WP_011079557.1.78369 WP_011079557.1.78668 WP_011079557.1.79678 WP_011079557.1.81060 WP_011079557.1.81460 WP_011079557.1.81555 WP_011079557.1.82587 WP_011079557.1.8292 WP_011079557.1.8379 WP_011079557.1.84562 WP_011079557.1.86005 WP_011079557.1.86748 WP_011079557.1.89979 WP_011079557.1.90288 WP_011079557.1.93668 WP_011079557.1.95941 WP_011079557.1.96968 WP_011079557.1.9921 WP_011079557.1.99976 gi|320155380|ref|YP_004187759.1| 196600.VV2771 gi|37680955|ref|NP_935564.1| gi|326423859|ref|NP_760524.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]