SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37680971|ref|NP_935580.1| from Vibrio vulnificus YJ016

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37680971|ref|NP_935580.1|
Domain Number 1 Region: 12-100
Classification Level Classification E-value
Superfamily Translation proteins 7.42e-24
Family RimM N-terminal domain-like 0.00082
Further Details:      
 
Domain Number 2 Region: 106-182
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.35e-20
Family RimM C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37680971|ref|NP_935580.1|
Sequence length 182
Comment 16S rRNA-processing protein RimM [Vibrio vulnificus YJ016]
Sequence
MSMKGKETMSDERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYSPWYVNQKGEWVEFKV
ESWKRHNKGMVAKLEGLDVREDAHLLTNLEIAIDPAVLPELSEDEFYWRELFGMQVVTTN
GYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQVIIKVDREAQRIEVDWDP
GF
Download sequence
Identical sequences A0A0H0Y485 A0A1W6M6Q7 Q7MHT2 Q8DC32
gi|27364980|ref|NP_760508.1| 196600.VV2787 216895.VV1_1616 gi|37680971|ref|NP_935580.1| WP_011079542.1.100126 WP_011079542.1.17874 WP_011079542.1.21633 WP_011079542.1.22778 WP_011079542.1.25536 WP_011079542.1.33883 WP_011079542.1.34622 WP_011079542.1.54486 WP_011079542.1.54858 WP_011079542.1.59022 WP_011079542.1.66581 WP_011079542.1.73066 WP_011079542.1.78369 WP_011079542.1.79678 WP_011079542.1.81060 WP_011079542.1.81460 WP_011079542.1.8292 WP_011079542.1.89979 WP_011079542.1.93668 WP_011079542.1.9921 WP_011079542.1.99976 gi|320155364|ref|YP_004187743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]